PDB entry 2fp1

View 2fp1 on RCSB PDB site
Description: Secreted Chorismate Mutase from Mycobacterium tuberculosis
Class: isomerase
Keywords: alpha-helical, ISOMERASE
Deposited on 2006-01-15, released 2006-03-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.176
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chorismate mutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fp1a_
  • Chain 'B':
    Compound: chorismate mutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fp1b_
  • Heterogens: PB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fp1A (A:)
    dgtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdy
    vtrvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshws
    llsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fp1A (A:)
    gtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdyv
    trvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshwsl
    lsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fp1B (B:)
    dgtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdy
    vtrvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshws
    llsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fp1B (B:)
    tsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdyvt
    rvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshwsll
    sapscaaqldrakrdivrsrhldslyqralttatqsycqalppa