PDB entry 2fp1

View 2fp1 on RCSB PDB site
Description: Secreted Chorismate Mutase from Mycobacterium tuberculosis
Class: isomerase
Keywords: alpha-helical
Deposited on 2006-01-15, released 2006-03-28
The last revision prior to the SCOP 1.73 freeze date was dated 2006-04-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.176
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chorismate mutase
    Species: Mycobacterium tuberculosis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fp1a1
  • Chain 'B':
    Compound: chorismate mutase
    Species: Mycobacterium tuberculosis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fp1b1
  • Heterogens: PB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fp1A (A:)
    dgtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdy
    vtrvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshws
    llsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fp1A (A:)
    gtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdyv
    trvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshwsl
    lsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fp1B (B:)
    dgtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdy
    vtrvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshws
    llsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fp1B (B:)
    tsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdyvt
    rvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshwsll
    sapscaaqldrakrdivrsrhldslyqralttatqsycqalppa