PDB entry 2foy

View 2foy on RCSB PDB site
Description: Human Carbonic Anhydrase I complexed with a two-prong inhibitor
Class: lyase
Keywords: lyase, zinc, inhibitor, copper
Deposited on 2006-01-14, released 2006-04-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2foya_
  • Chain 'B':
    Compound: Carbonic anhydrase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2foyb_
  • Heterogens: ZN, B30, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2foyA (A:)
    aspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeii
    nvghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhv
    ahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfd
    pstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavp
    mqhnnrptqplkgrtvrasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2foyA (A:)
    wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
    sfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
    sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
    lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
    nrptqplkgrtvrasf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2foyB (B:)
    aspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeii
    nvghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhv
    ahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfd
    pstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavp
    mqhnnrptqplkgrtvrasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2foyB (B:)
    dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
    hsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
    nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
    llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
    nnrptqplkgrtvrasf