PDB entry 2fow

View 2fow on RCSB PDB site
Description: the rna binding domain of ribosomal protein l11: three-dimensional structure of the rna-bound form of the protein, nmr, 26 structures
Deposited on 1997-05-26, released 1997-11-26
The last revision prior to the SCOP 1.55 freeze date was dated 1997-11-26, with a file datestamp of 1997-11-26.
Experiment type: NMR26
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2fow__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fow_ (-)
    mtfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaam
    rmiegtarsmgivved