PDB entry 2fom

View 2fom on RCSB PDB site
Description: Dengue Virus NS2B/NS3 Protease
Class: viral protein/protease
Keywords: FLAVIVIRUS, NS3 protease, NS2B cofactor, VIRAL PROTEIN-PROTEASE COMPLEX
Deposited on 2006-01-13, released 2006-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyprotein
    Species: Dengue virus [TaxId:11060]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91H74 (6-52)
      • cloning artifact (0-5)
      • cloning artifact (53)
    Domains in SCOPe 2.07: d2foma1, d2foma2, d2foma3
  • Chain 'B':
    Compound: Polyprotein
    Species: Dengue virus [TaxId:11060]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fomb1
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fomA (A:)
    gshmleadleleraadvrweeqaeisgsspilsitisedgsmsikneeeeqtlggggsgg
    gg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fomA (A:)
    gshmleadleleraadvrweeqaeisgsspilsisikneeeeqtlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fomB (B:)
    agvlwdvpspppvgkaeledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmh
    kgkriepswadvkkdlisygggwklegewkegeevqvlalepgknpravqtkpglfktnt
    gtigavsldfspgtsgspivdkkgkvvglygngvvtrsgayvsaianteksiednpeied
    difrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fomB (B:)
    ledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmhkgkriepswadvkkdli
    sygggwklegewkegeevqvlalepgknpravqtkpglfktntgtigavsldfspgtsgs
    pivdkkgkvvglygngvvtrsgayvsaian