PDB entry 2foh

View 2foh on RCSB PDB site
Description: Structure of porcine pancreatic elastase in 40% trifluoroethanol
Class: hydrolase
Keywords: elastase; solvent mapping; organic solvents; protein binding sites; multiple solvent crystal structures
Deposited on 2006-01-13, released 2006-04-18
The last revision prior to the SCOP 1.73 freeze date was dated 2006-04-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.167
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elastase-1
    Species: SUS SCROFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00772 (0-239)
      • conflict (65)
    Domains in SCOP 1.73: d2foha1
  • Heterogens: CA, SO4, ETF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fohA (A:)
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn