PDB entry 2fo8

View 2fo8 on RCSB PDB site
Description: Solution structure of the Trypanosoma cruzi cysteine protease inhibitor chagasin
Class: hydrolase inhibitor
Keywords: Chagasin; Ig-like domain; cysteine protease inhibitor; Trypanosoma cruzi, HYDROLASE INHIBITOR
Deposited on 2006-01-13, released 2006-04-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chagasin
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: cha
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fo8a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fo8A (A:)
    gsshkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfp
    pdskllgaggtehfhvtvkaagthavnltymrpwtgpshdserftvylkan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fo8A (A:)
    hkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfppds
    kllgaggtehfhvtvkaagthavnltymrpwtgpshdserftvylkan