PDB entry 2fo3

View 2fo3 on RCSB PDB site
Description: Plasmodium vivax ubiquitin conjugating enzyme E2
Class: structural genomics, unknown function
Keywords: SGC, UBC, Structural Genomics, Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2006-01-12, released 2006-01-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-20.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.209
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme
    Species: Plasmodium vivax [TaxId:5855]
    Gene: OST6, PVX_083175
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2fo3a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fo3A (A:)
    kynmgnanyriqkelhnflnnppinctldvhpnniriwivkyvglentiyanevyklkii
    fpddyplkppivyflqkppkhthvysngdiclsllgddynpslsisglvlsiismlssak
    ekklp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fo3A (A:)
    yriqkelhnflnnppinctldvhpnniriwivkyvglentiyanevyklkiifpddyplk
    ppivyflqkppkhthvysngdiclsllgddynpslsisglvlsiismls