PDB entry 2fo3

View 2fo3 on RCSB PDB site
Description: Plasmodium vivax ubiquitin conjugating enzyme E2
Class: structural genomics, unknown function
Keywords: SGC, UBC, Structural Genomics, Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2006-01-12, released 2006-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme
    Species: Plasmodium vivax [TaxId:5855]
    Gene: OST6, PVX_083175
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fo3a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2fo3A (A:)
kynmgnanyriqkelhnflnnppinctldvhpnniriwivkyvglentiyanevyklkii
fpddyplkppivyflqkppkhthvysngdiclsllgddynpslsisglvlsiismlssak
ekklp

    Sequence, based on observed residues (ATOM records): (download) 
    >2fo3A (A:)
yriqkelhnflnnppinctldvhpnniriwivkyvglentiyanevyklkiifpddyplk
ppivyflqkppkhthvysngdiclsllgddynpslsisglvlsiismls