PDB entry 2fo0

View 2fo0 on RCSB PDB site
Description: Organization of the SH3-SH2 Unit in Active and Inactive Forms of the c-Abl Tyrosine Kinase
Class: transferase
Keywords: N-terminal cap, autoinhibition, myristoylation, SH3-SH2 clamp, phosphoserine, TRANSFERASE
Deposited on 2006-01-12, released 2006-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1 (1B ISOFORM)
    Species: Homo sapiens [TaxId:9606]
    Gene: c-Abl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fo0a1, d2fo0a2, d2fo0a3
  • Heterogens: MYR, P16, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fo0A (A:)
    mgqqpgkvlgdqrrepqglseaarwnskenllagpsendpnlfvalydfvasgdntlsit
    kgeklrvlgynhngewceaqtkngqgwvpsnyitpvnslekhswyhgpvsrnaaeyllss
    gingsflvresesspgqrsislryegrvyhyrintasdgklyvssesrfntlaelvhhhs
    tvadglittlhypapkrnkptvygvspnydkwemertditmkhklgggqygevyegvwkk
    ysltvavktlkedtmeveeflkeaavmkeikhpnlvqllgvctreppfyiitefmtygnl
    ldylrecnrqevnavvllymatqissameylekknfihrnlaarnclvgenhlvkvadfg
    lsrlmtgdtytahagakfpikwtapeslaynkfsiksdvwafgvllweiatygmspypgi
    dlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrpsfaeihqafetmfqessis
    devekelgkenlygq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fo0A (A:)
    arwnskenllagpsendpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtk
    ngqgwvpsnyitpvnslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsisl
    ryegrvyhyrintasdgklyvssesrfntlaelvhhhstvadglittlhypapkrnkptv
    ygvspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflk
    eaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymat
    qissameylekknfihrnlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikw
    tapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcp
    ekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelg