PDB entry 2fnx

View 2fnx on RCSB PDB site
Description: Design of Specific Peptide Inhibitors of Phospholipase A2 (PLA2): Crystal Structure of the Complex of PLA2 with a Highly Potent Peptide Val-Ile-Ala-Lys at 2.7A Resolution
Class: hydrolase
Keywords: peptide inhibitor complex
Deposited on 2006-01-11, released 2006-01-24
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.193
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 VRV-PL-VIIIa
  Species: Daboia russelli pulchella
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59071 (0-110)
  Domains in SCOP 1.73: d2fnxa1
• Chain 'P':
  Compound: Inhibitor peptide
  Species: synthetic, synthetic
  
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fnxA (A:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c
  

  
  
• Chain 'P':
  No sequence available.