PDB entry 2fnw

View 2fnw on RCSB PDB site
Description: Pseudomonas aeruginosa E2Q/H83Q/M109H-azurin RE(PHEN)(CO)3
Class: metal binding protein
Keywords: blue-copper, electron-transfer, rhenium, infrared spectroscopy, metal binding protein
Deposited on 2006-01-11, released 2006-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.195
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Azurin
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: AZU, PA4922
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00282
    • engineered (1)
    • engineered (82)
    • engineered (108)
  Domains in SCOPe 2.08: d2fnwa_
• Chain 'B':
  Compound: Azurin
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: AZU, PA4922
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00282 (0-127)
    • engineered (1)
    • engineered (82)
    • engineered (108)
  Domains in SCOPe 2.08: d2fnwb_
• Heterogens: CU, REP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fnwA (A:)
  aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
  tdgmasgldkdylkpddsrviaqtkligsgekdsvtfdvsklkegeqyhffctfpghsal
  mkgtltlk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fnwB (B:)
  aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
  tdgmasgldkdylkpddsrviaqtkligsgekdsvtfdvsklkegeqyhffctfpghsal
  mkgtltlk