PDB entry 2fnt

View 2fnt on RCSB PDB site
Description: Crystal structure of a drug-resistant (V82A) inactive (D25N) HIV-1 protease complexed with AP2V variant of HIV-1 NC-p1 substrate.
Class: hydrolase
Keywords: structural intermediate, substrate recognition, hiv-1 protease, NC-p1 substrate, drug resistance, flap conformation, HYDROLASE
Deposited on 2006-01-11, released 2006-09-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O38716 (0-98)
    • engineered (6)
    • engineered (24)
    • engineered (63)
    • engineered (81)
  Domains in SCOPe 2.08: d2fnta_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O38716 (0-98)
    • engineered (6)
    • engineered (24)
    • engineered (63)
    • engineered (81)
  Domains in SCOPe 2.08: d2fntb_
• Chain 'P':
  Compound: nc-p1 substrate peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 2FNT (0-End)
• Heterogens: ACT, PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fntA (A:)
  pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveicghkaigtvlvgptpaniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fntB (B:)
  pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveicghkaigtvlvgptpaniigrnlltqigctlnf
  

  
  
• Chain 'P':
  No sequence available.