PDB entry 2fnp

View 2fnp on RCSB PDB site
Description: Crystal structure of SarA
Class: transcription
Keywords: wing-helix, DNA binding
Deposited on 2006-01-11, released 2006-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 2006-03-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.285
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Staphylococcal accessory regulator A
    Species: Staphylococcus aureus
    Gene: sarA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2fnpa1
  • Chain 'B':
    Compound: Staphylococcal accessory regulator A
    Species: Staphylococcus aureus
    Gene: sarA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2fnpb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fnpA (A:)
    maitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyyfkdiinhl
    nykqpqvvkavkilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrvnkriteann
    eiel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fnpA (A:)
    itkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyyfkdiinhlny
    kqpqvvkavkilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrvnkriteannei
    el
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fnpB (B:)
    maitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyyfkdiinhl
    nykqpqvvkavkilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrvnkriteann
    eiel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fnpB (B:)
    itkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyyfkdiinhlny
    kqpqvvkavkilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrvnkriteannei
    el