PDB entry 2fnj

View 2fnj on RCSB PDB site
Description: Crystal structure of a B30.2/SPRY domain-containing protein GUSTAVUS in complex with Elongin B and Elongin C
Class: protein transport/signaling protein
Keywords: Beta-sandwich, Lectin-like, B30.2, SPRY
Deposited on 2006-01-11, released 2006-03-21
The last revision prior to the SCOP 1.75 freeze date was dated 2006-04-04, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.218
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CG2944-PF, isoform F
    Species: Drosophila melanogaster
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2fnja1
  • Chain 'B':
    Compound: Transcription elongation factor B polypeptide 2
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2fnjb1
  • Chain 'C':
    Compound: Transcription elongation factor B polypeptide 1
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2fnjc1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fnjA (A:)
    mrelqadfvkparidilldmppasrdlqlkhswnsedrslnifvkeddkltfhrhpvaqs
    tdcirgkvgltkglhiweiywptrqrgthavvgvctadaplhsvgyqslvgsteqswgwd
    lgrnklyhdskncagvtypailkndeaflvpdkflvaldmdegtlsfivdqqylgiafrg
    lrgkklypivsavwghceitmryiggldpeplplmdlcrrtirqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fnjA (A:)
    fvkparidilldmppasrdlqlkhswnsedrslnifvkeddkltfhrhpvaqstdcirgk
    vgltkglhiweiywptrqrgthavvgvctadaplhsvgyqslvgsteqswgwdlgrnkly
    hdskncagvtypailkndeaflvpdkflvaldmdegtlsfivdqqylgiafrglrgkkly
    pivsavwghceitmryiggldpeplplmdlcrrtirq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fnjB (B:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppeeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealriepfssppelpdvmkpqdsggsaneqavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fnjB (B:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppeeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealriepfssppe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fnjC (C:)
    myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
    ftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fnjC (C:)
    myvklissdghefivkrehaltsgtikamlsgpnevnfreipshvlskvcmyftykvryt
    nssteipefpiapeialellmaanfldc