PDB entry 2fni

View 2fni on RCSB PDB site
Description: PseC aminotransferase involved in pseudoaminic acid biosynthesis
Class: transferase
Keywords: aminotransferase, Structural Genomics, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI
Deposited on 2006-01-11, released 2006-01-24
The last revision prior to the SCOP 1.73 freeze date was dated 2006-04-11, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.199
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminotransferase
    Species: Helicobacter pylori
    Gene: hp0366
    Database cross-references and differences (RAF-indexed):
    • GB AAD07433 (0-End)
    Domains in SCOP 1.73: d2fnia1
  • Chain 'B':
    Compound: aminotransferase
    Species: Helicobacter pylori
    Gene: hp0366
    Database cross-references and differences (RAF-indexed):
    • GB AAD07433 (0-End)
    Domains in SCOP 1.73: d2fnib1
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fniA (A:)
    mkefaysepcldkedkkavlevlnskqltqgkrsllfeealceflgvkhalvfnsatsal
    ltlyrnfsefsadrneiittpisfvatanmllesgytpvfagikndgnidelalekline
    rtkaivsvdyagksvevesvqklckkhslsflsdsshalgseyqnkkvggfalasvfsfh
    aikpittaeggavvtndselhekmklfrshgmlkkdffegevksighnfrlneiqsalgl
    sqlkkapflmqkreeaaltydrifkdnpyftplhpllkdkssnhlypilmhqkfftckkl
    ileslhkrgilaqvhykpiyqyqlyqqlfntaplksaedfyhaeislpchanlnlesvqn
    iahsvlktfesfkie
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fniA (A:)
    mkefaysepcldkedkkavlevlnskqltqgkrsllfeealceflgvkhalvfnsatsal
    ltlyrnfsefsadrneiittpisfvatanmllesgytpvfagikndgnidelalekline
    rtkaivsvdyagksvevesvqklckkhslsflsdsshalgseyqnkkvggfalasvfsfh
    aikpittaeggavvtndselhekmklfrshgmlkkdffegevksighnfrlneiqsalgl
    sqlkkapflmqkreeaaltydrifkdnpyftplhpllkdkssnhlypilmhqkfftckkl
    ileslhkrgilaqvhykpiyqyqlyqqlfntaplksaedfyhaeislpchanlnlesvqn
    iahsvlktfesfki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fniB (B:)
    mkefaysepcldkedkkavlevlnskqltqgkrsllfeealceflgvkhalvfnsatsal
    ltlyrnfsefsadrneiittpisfvatanmllesgytpvfagikndgnidelalekline
    rtkaivsvdyagksvevesvqklckkhslsflsdsshalgseyqnkkvggfalasvfsfh
    aikpittaeggavvtndselhekmklfrshgmlkkdffegevksighnfrlneiqsalgl
    sqlkkapflmqkreeaaltydrifkdnpyftplhpllkdkssnhlypilmhqkfftckkl
    ileslhkrgilaqvhykpiyqyqlyqqlfntaplksaedfyhaeislpchanlnlesvqn
    iahsvlktfesfkie
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fniB (B:)
    mkefaysepcldkedkkavlevlnskqltqgkrsllfeealceflgvkhalvfnsatsal
    ltlyrnfsefsadrneiittpisfvatanmllesgytpvfagikndgnidelalekline
    rtkaivsvdyagksvevesvqklckkhslsflsdsshalgseyqnkkvggfalasvfsfh
    aikpittaeggavvtndselhekmklfrshgmlkkdffegevksighnfrlneiqsalgl
    sqlkkapflmqkreeaaltydrifkdnpyftplhpllkdkssnhlypilmhqkfftckkl
    ileslhkrgilaqvhykpiyqyqlyqqlfntaplksaedfyhaeislpchanlnlesvqn
    iahsvlktfesfki