PDB entry 2fnb

View 2fnb on RCSB PDB site
Description: nmr structure of the fibronectin ed-b domain, nmr, 20 structures
Deposited on 1998-12-16, released 1998-12-23
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d2fnba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fnbA (A:)
  mrgsevpqltdlsfvditdssiglrwtplnsstiigyritvvaagegipifedfvdssvg
  yytvtglepgidydisvitlinggesapttltqqt