PDB entry 2fn7

View 2fn7 on RCSB PDB site
Description: Crystal structure of the lactate dehydrogenase from cryptosporidium parvum complexed with substrate (lactic acid) and cofactor (b-nicotinamide adenine dinucleotide)
Class: oxidoreductase
Keywords: Enzyme_substrate_cofactor complex, OXIDOREDUCTASE
Deposited on 2006-01-10, released 2007-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Gene: LDH1
    Database cross-references and differences (RAF-indexed):
    • GB AAG17668 (0-End)
      • see remark 999 (183)
    Domains in SCOPe 2.07: d2fn7a1, d2fn7a2
  • Chain 'B':
    Compound: lactate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Gene: LDH1
    Database cross-references and differences (RAF-indexed):
    • GB AAG17668 (0-End)
      • see remark 999 (183)
    Domains in SCOPe 2.07: d2fn7b1, d2fn7b2
  • Heterogens: NAD, LAC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fn7A (A:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnapaaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fn7A (A:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fn7B (B:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnapaaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fn7B (B:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnap