PDB entry 2fn5

View 2fn5 on RCSB PDB site
Description: NMR Structure of the Neurabin PDZ domain (502-594)
Class: signaling protein
Keywords: PDZ, Neurabin, SIGNALING PROTEIN
Deposited on 2006-01-10, released 2007-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurabin-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ppp1r9a
    Database cross-references and differences (RAF-indexed):
    • Uniprot O35867 (3-93)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d2fn5a1, d2fn5a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fn5A (A:)
    ghmelfpvelekdedglgisiigmgvgadagleklgifvktvteggaaqrdgriqvndqi
    vevdgislvgvtqnfaatvlrntkgnvrfvigre