PDB entry 2fn4

View 2fn4 on RCSB PDB site
Description: The crystal structure of human Ras-related protein, RRAS, in the GDP-bound state
Class: signaling protein
Keywords: RRAS, GDP/GTP binding, GTP hydrolysis, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2006-01-10, released 2006-01-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.216
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein R-Ras
    Species: Homo sapiens [TaxId:9606]
    Gene: RRAS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2fn4a1
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fn4A (A:)
    smdpppsethklvvvggggvgksaltiqfiqsyfvsdydptiedsytkicsvdgiparld
    ildtagqeefgamreqymraghgfllvfaindrqsfnevgklftqilrvkdrddfpvvlv
    gnkadlesqrqvprseasafgashhvayfeasaklrlnvdeafeqlvravrkyqeqelpp
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fn4A (A:)
    pppsethklvvvggggvgksaltiqfiqsyfvsdydptiedsytkicsvdgiparldild
    tagqeefgamreqymraghgfllvfaindrqsfnevgklftqilrvkdrddfpvvlvgnk
    adlesqrqvprseasafgashhvayfeasaklrlnvdeafeqlvravrkyqeq