PDB entry 2fn2

View 2fn2 on RCSB PDB site
Description: solution nmr structure of the glycosylated second type two module of fibronectin, 20 structures
Class: glycoprotein
Keywords: glycoprotein, fibronectin, type two module, nmr structure, glycosylated protein, collagen
Deposited on 1997-08-06, released 1998-09-16
The last revision prior to the SCOP 1.73 freeze date was dated 1998-09-16, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fibronectin
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02751 (0-58)
  Domains in SCOP 1.73: d2fn2a_
• Heterogens: NAG

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fn2A (A:)
  vlvqtrggnsngalchfpflynnhnytdctsegrrdnmkwcgttqnydadqkfgfcpma