PDB entry 2fn2

View 2fn2 on RCSB PDB site
Description: solution nmr structure of the glycosylated second type two module of fibronectin, 20 structures
Deposited on 1997-08-06, released 1998-09-16
The last revision prior to the SCOP 1.57 freeze date was dated 1998-09-16, with a file datestamp of 1998-09-16.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2fn2__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fn2_ (-)
    vlvqtrggnsngalchfpflynnhnytdctsegrrdnmkwcgttqnydadqkfgfcpma