PDB entry 2fn0

View 2fn0 on RCSB PDB site
Description: Crystal structure of Yersinia enterocolitica salicylate synthase (Irp9)
Class: transcription
Keywords: Yersinia enterocolitica, Irp9, salicylate synthase, siderophore, TRANSCRIPTION
Deposited on 2006-01-10, released 2006-02-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: salicylate synthetase, Irp9
    Species: Yersinia enterocolitica [TaxId:630]
    Gene: IRP9
    Database cross-references and differences (RAF-indexed):
    • GB CAB46570 (Start-436)
    Domains in SCOPe 2.08: d2fn0a1, d2fn0a2
  • Chain 'B':
    Compound: salicylate synthetase, Irp9
    Species: Yersinia enterocolitica [TaxId:630]
    Gene: IRP9
    Database cross-references and differences (RAF-indexed):
    • GB CAB46570 (3-436)
    Domains in SCOPe 2.08: d2fn0b2, d2fn0b3
  • Heterogens: ACT, MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fn0A (A:)
    gshmkiseflhlalpeeqwlptisgvlrqfaeeecyvyerppcwylgkgcqarlhinadg
    tqatfiddageqkwavdsiadcarrfmahpqvkgrrvygqvgfnfaahargiafnagewp
    lltltvpreelifekgnvtvyadsadgcrrlcewvkeastttqnaplavdtalngeaykq
    qvaravaeirrgeyvkvivsraiplpsridmpatllygrqantpvrsfmfrqegrealgf
    spelvmsvtgnkvvteplagtrdrmgnpehnkakeaellhdskevlehilsvkeaiaele
    avclpgsvvvedlmsvrqrgsvqhlgsgvsgqlaenkdawdaftvlfpsitasgipknaa
    lnaimqiektprelysgailllddtrfdaalvlrsvfqdsqrcwiqagagiiaqstpere
    ltetreklasiapylmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fn0A (A:)
    kiseflheeqwlptisgvlrqfaeeecyvyerppcwylgkgcqarlhinadgtqatfidd
    ageqkwavdsiadcarrfmahpqvkgrrvygqvgfnfaahargiafnagewplltltvpr
    eelifekgnvtvyadaplavdtalngeaykqqvaravaeirrgeyvkvivsraiplpsri
    dmpatllygrqantpvrsfmfrqegrealgfspelvmsvtgnkvvteplagtrdrmgnpe
    hnkakeaellhdskevlehilsvkeaiaeleavclpgsvvvedlmsvrqrgsvqhlgsgv
    sgqlaenkdawdaftvlfpsitasgipknaalnaimqiektprelysgailllddtrfda
    alvlrsvfqdsqrcwiqagagiiaqstpereltetreklasiapylmv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fn0B (B:)
    gshmkiseflhlalpeeqwlptisgvlrqfaeeecyvyerppcwylgkgcqarlhinadg
    tqatfiddageqkwavdsiadcarrfmahpqvkgrrvygqvgfnfaahargiafnagewp
    lltltvpreelifekgnvtvyadsadgcrrlcewvkeastttqnaplavdtalngeaykq
    qvaravaeirrgeyvkvivsraiplpsridmpatllygrqantpvrsfmfrqegrealgf
    spelvmsvtgnkvvteplagtrdrmgnpehnkakeaellhdskevlehilsvkeaiaele
    avclpgsvvvedlmsvrqrgsvqhlgsgvsgqlaenkdawdaftvlfpsitasgipknaa
    lnaimqiektprelysgailllddtrfdaalvlrsvfqdsqrcwiqagagiiaqstpere
    ltetreklasiapylmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fn0B (B:)
    mkiseflhlalpeeqwlptisgvlrqfaeeecyvyerppcwylgkgcqarlhinadgtqa
    tfiddageqkwavdsiadcarrfmahpqvkgrrvygqvgfnfaahargiafnagewpllt
    ltvpreelifekgnvtvyadplavdtalngeaykqqvaravaeirrgeyvkvivsraipl
    psridmpatllygrqantpvrsfmfrqegrealgfspelvmsvtgnkvvteplagtrdrm
    gnpehnkakeaellhdskevlehilsvkeaiaeleavclpgsvvvedlmsvrqrgsvqhl
    gsgvsgqlaenkdawdaftvlfpsitasgipknaalnaimqiektprelysgailllddt
    rfdaalvlrsvfqdsqrcwiqagagiiaqstpereltetreklasiapylmv