PDB entry 2fmu

View 2fmu on RCSB PDB site
Description: Crystal structure of Tat-interacting protein 30 kDa (HIV-1 tat interactive protein 2, 30 kDa homolog) (Human) (16924205) from Mus musculus at 2.30 A resolution
Class: structural genomics, unknown function
Keywords: 16924205, Tat-interacting protein 30 kDa (HIV-1 tat interactive protein 2, 30 kDa homolog) (Human), Structural Genomics, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG
Deposited on 2006-01-09, released 2006-02-28
The last revision prior to the SCOP 1.75 freeze date was dated 2006-02-28, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.206
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HIV-1 tat interactive protein 2, 30 kDa homolog
    Species: MUS MUSCULUS
    Gene: 16924205
    Database cross-references and differences (RAF-indexed):
    • GB AAH17372 (12-End)
      • leader sequence (6-11)
    Domains in SCOP 1.75: d2fmua1
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fmuA (A:)
    mgsdkihhhhhhlpklredfkmqnksvfilgasgetgkvllkeilgqnlfskvtligrrk
    ltfeeeayknvnqevvdfekldvyasafqghdvgfcclgttrskagaegfvrvdrdyvlk
    saelakaggckhfnllssrgadksssflylqvkgeveakveelkfdrlsvfrpgvllcdr
    qesrpgewlarkffgslpdswasgyavpvvtvvramlnnlvspssgqmellenkailhlg
    kdrdvpkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fmuA (A:)
    hhhhhhlpklredfkmqnksvfilgasgetgkvllkeilgqnlfskvtligrrkltfykn
    vnqevvdfekldvyasafqghdvgfcclgtkagaegfvrvdrdyvlksaelakaggckhf
    nllssrgadksssflylqvkgeveakveelkfdrlsvfrpgvllcdswasgyavpvvtvv
    ramlnnlvspssgqmellenkailhlgkd