PDB entry 2fmt

View 2fmt on RCSB PDB site
Description: methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet
Class: complex (methyltransferase/tRNA)
Keywords: complex (methyltransferase/tRNA), formyltransferase, initiation of translation
Deposited on 1998-07-29, released 1999-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.247
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methionyl-tRNA fmet formyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: FMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fmta1, d2fmta2
  • Chain 'B':
    Compound: methionyl-tRNA fmet formyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: FMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fmtb1, d2fmtb2
  • Chain 'C':
    Compound: formyl-methionyl-trnafmet2
  • Chain 'D':
    Compound: formyl-methionyl-trnafmet2
  • Heterogens: MG, FME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fmtA (A:)
    seslriifagtpdfaarhldallssghnvvgvftqpdrpagrgkklmpspvkvlaeekgl
    pvfqpvslrpqenqqlvaelqadvmvvvayglilpkavlemprlgcinvhgsllprwrga
    apiqrslwagdaetgvtimqmdvgldtgdmlyklscpitaedtsgtlydklaelgpqgli
    ttlkqladgtakpevqdetlvtyaeklskeearidwslsaaqlercirafnpwpmswlei
    egqpvkvwkasvidtatnaapgtileankqgiqvatgdgilnllslqpagkkamsaqdll
    nsrrewfvpgnrlv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fmtB (B:)
    seslriifagtpdfaarhldallssghnvvgvftqpdrpagrgkklmpspvkvlaeekgl
    pvfqpvslrpqenqqlvaelqadvmvvvayglilpkavlemprlgcinvhgsllprwrga
    apiqrslwagdaetgvtimqmdvgldtgdmlyklscpitaedtsgtlydklaelgpqgli
    ttlkqladgtakpevqdetlvtyaeklskeearidwslsaaqlercirafnpwpmswlei
    egqpvkvwkasvidtatnaapgtileankqgiqvatgdgilnllslqpagkkamsaqdll
    nsrrewfvpgnrlv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.