PDB entry 2fmr

View 2fmr on RCSB PDB site
Description: kh1 from the fragile x protein fmr1, nmr, 18 structures
Deposited on 1997-10-06, released 1998-04-08
The last revision prior to the SCOP 1.55 freeze date was dated 1998-04-08, with a file datestamp of 1998-04-08.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2fmr__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fmr_ (-)
    asrfheqfivredlmglaigthganiqqarkvpgvtaidldedtctfhiygedqdavkka
    rsfle