PDB entry 2fmm

View 2fmm on RCSB PDB site
Description: Crystal Structure of EMSY-HP1 complex
Class: transcription
Keywords: ent domain, chromo shadow domain, emsy protein, heterochromatin protein 1, transcription
Deposited on 2006-01-09, released 2006-05-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.219
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chromobox protein homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX1, CBX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2fmma_
  • Chain 'B':
    Compound: chromobox protein homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX1, CBX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2fmmb_
  • Chain 'C':
    Compound: chromobox protein homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX1, CBX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2fmmc_
  • Chain 'D':
    Compound: chromobox protein homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX1, CBX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2fmmd_
  • Chain 'E':
    Compound: Protein EMSY
    Species: Homo sapiens [TaxId:9606]
    Gene: EMSY, C11orf30
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7Z589 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.01: d2fmme1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fmmA (A:)
    gskeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
    sfyeerltwhsyps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fmmA (A:)
    ekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeer
    ltwhsyps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fmmB (B:)
    gskeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
    sfyeerltwhsyps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fmmB (B:)
    kprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeerl
    twhsyps
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fmmC (C:)
    gskeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
    sfyeerltwhsyps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fmmC (C:)
    kprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeerl
    twhsyps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fmmD (D:)
    gskeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
    sfyeerltwhsyps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fmmD (D:)
    prgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeerlt
    whsyps
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2fmmE (E:)
    gpldlsrdeckrilrkleleayagvisalraqgdltkekkdllgelskvlsisterhrae
    vrravnderlttiahnmsgpnsssewsiegrrlvplmprlvpqtaftvtanavanaaiqh
    naslpvpaetgsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fmmE (E:)
    gpldlsrdeckrilrkleleayagvisalraqgdltkekkdllgelskvlsisterhrae
    vrravnderlttiahnmsgpnsssewsiegrrlvplmprlvpqtaftvtanavanaai