PDB entry 2fmm

View 2fmm on RCSB PDB site
Description: Crystal Structure of EMSY-HP1 complex
Class: transcription
Keywords: ent domain, chromo shadow domain, emsy protein, heterochromatin protein 1
Deposited on 2006-01-09, released 2006-05-23
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.219
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chromobox protein homolog 1
    Species: HOMO SAPIENS
    Gene: CBX1, CBX
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fmma1
  • Chain 'B':
    Compound: chromobox protein homolog 1
    Species: HOMO SAPIENS
    Gene: CBX1, CBX
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fmmb1
  • Chain 'C':
    Compound: chromobox protein homolog 1
    Species: HOMO SAPIENS
    Gene: CBX1, CBX
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fmmc1
  • Chain 'D':
    Compound: chromobox protein homolog 1
    Species: HOMO SAPIENS
    Gene: CBX1, CBX
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fmmd1
  • Chain 'E':
    Compound: Protein EMSY
    Species: HOMO SAPIENS
    Gene: EMSY, C11orf30
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7Z589 (2-End)
      • cloning artifact (0-1)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fmmA (A:)
    gskeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
    sfyeerltwhsyps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fmmA (A:)
    ekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeer
    ltwhsyps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fmmB (B:)
    gskeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
    sfyeerltwhsyps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fmmB (B:)
    kprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeerl
    twhsyps
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fmmC (C:)
    gskeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
    sfyeerltwhsyps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fmmC (C:)
    kprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeerl
    twhsyps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fmmD (D:)
    gskeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
    sfyeerltwhsyps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fmmD (D:)
    prgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeerlt
    whsyps
    

  • Chain 'E':
    No sequence available.