PDB entry 2fme

View 2fme on RCSB PDB site
Description: Crystal structure of the mitotic kinesin eg5 (ksp) in complex with mg-adp and (r)-4-(3-hydroxyphenyl)-n,n,7,8-tetramethyl-3,4-dihydroisoquinoline-2(1h)-carboxamide
Class: cell cycle
Keywords: Eg5 KSP Mg-ADP Complex Inhibitor, CELL CYCLE
Deposited on 2006-01-09, released 2006-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11, EG5, KNSL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fmea_
  • Chain 'B':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11, EG5, KNSL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fmeb_
  • Heterogens: MG, 3QC, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fmeA (A:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fmeA (A:)
    kniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggssrktytfdmvfgastkqid
    vyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiiprtl
    hqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviikgle
    eitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkvkigklnlvdlags
    enigrinqslltlgrvitalvertphvpyreskltrilqdslggrtrtsiiatispasln
    leetlstleyahraknilnkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fmeB (B:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fmeB (B:)
    kniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggssrktytfdmvfgastkqid
    vyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiiprtl
    hqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviikgle
    eitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvkigk
    lnlvdlagsenigrinqslltlgrvitalvertphvpyreskltrilqdslggrtrtsii
    atispaslnleetlstleyahraknilnk