PDB entry 2fmd

View 2fmd on RCSB PDB site
Description: Structural basis of carbohydrate recognition by Bowringia milbraedii seed agglutinin
Class: sugar binding protein
Keywords: LEGUME LECTIN, BETA SANDWICH, PROTEIN-CARBOHYDRATE COMPLEX, lectin, SUGAR BINDING PROTEIN
Deposited on 2006-01-09, released 2006-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Bowringia mildbraedii [TaxId:28956]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42088 (0-End)
      • see remark 999 (85)
      • see remark 999 (124)
      • see remark 999 (203)
      • see remark 999 (205-206)
    Domains in SCOPe 2.07: d2fmda_
  • Heterogens: CA, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fmdA (A:)
    ansvcftftdfesgqqdlifqgdasvgsnkalqltkvdskgnpqggsvgralytapirlw
    qssslvasfettftfsisqgsstpadaltffiaspdtkipsgsggrllglfgssnnagsd
    ngvvsvefdtypntdigdpnyrhigidvnsirskaaskwdwqngktatahisynsaskrl
    svvssypnsspvvvsfdvelnnvbpbwvrvgfsattgqytqtnnilawsfrsslmgyqan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fmdA (A:)
    ansvcftftdfesgqqdlifqgdasvgsnkalqltkvdskgnpqggsvgralytapirlw
    qssslvasfettftfsisqgsstpadaltffiaspdtkipsgsggrllglfgssndngvv
    svefdtypntdigdpnyrhigidvnsirskaaskwdwqngktatahisynsaskrlsvvs
    sypnsspvvvsfdvelnnvbpbwvrvgfsattgqytqtnnilawsfrsslmg