PDB entry 2fm9

View 2fm9 on RCSB PDB site
Description: Structure of Salmonella SipA residues 48-264
Class: cell invasion
Keywords: Salmonella, type II secretion, SipA, virulence, bacterial
Deposited on 2006-01-08, released 2006-03-21
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-21, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell invasion protein sipA
    Species: Salmonella typhimurium
    Gene: sipA, sspA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fm9a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fm9A (A:)
    pqledfpalikqasldalfkcgkdaealkevftnsnnvagkkaimefaglfrsalnatsd
    speaktllmkvgaeytaqiikdglkeksafgpwlpetkkaeaklenlekqlldiiknntg
    gelsklstnlvmqevmpyiasciehnfgctldpltrsnlthlvdkaaakavealdmchqk
    ltqeqgtsvgrearhlemqtliplllrnvfaqipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fm9A (A:)
    pqledfpalikqasldalfkcgkdaealkevftnsnnvagkkaimefaglfrsalnatsd
    speaktllmkvgaeytaqiikdglkeksafgpwlpetkkaeaklenlekqlldiiknntg
    gelsklstnlvmqevmpyiasciehnfgctldpltrsnlthlvdkaaakavealdmchqk
    hlemqtliplllrnvfaqipa