PDB entry 2fm4

View 2fm4 on RCSB PDB site
Description: NMR structure of the phosphoryl carrier domain of pyruvate phosphate dikinase
Class: transferase
Keywords: phosphohistidine carrier domain
Deposited on 2006-01-06, released 2006-10-03
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-03, with a file datestamp of 2007-06-04.
Experiment type: NMR11
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate, phosphate dikinase
    Species: Clostridium symbiosum
    Gene: PPDK
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fm4a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fm4A (A:)
aalkagevigsalpaspgaaagkvyftadeakaahekgervilvrletspediegmhaae
giltvrggmtshaavvargmgtccvsgcgeikineeaktfelgghtfaegdyisldgstg
kiykgdie