PDB entry 2fm4

View 2fm4 on RCSB PDB site
Description: NMR structure of the phosphoryl carrier domain of pyruvate phosphate dikinase
Class: transferase
Keywords: phosphohistidine carrier domain, TRANSFERASE
Deposited on 2006-01-06, released 2006-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate, phosphate dikinase
    Species: Clostridium symbiosum [TaxId:1512]
    Gene: PPDK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fm4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fm4A (A:)
    aalkagevigsalpaspgaaagkvyftadeakaahekgervilvrletspediegmhaae
    giltvrggmtshaavvargmgtccvsgcgeikineeaktfelgghtfaegdyisldgstg
    kiykgdie