PDB entry 2fm3

View 2fm3 on RCSB PDB site
Description: Crystal structure of the Lactate Dehydrogenase from Cryptosporidium parvum complexed with substrate (Pyruvic acid) and cofactor (b-Nicotinamide adenine dinucleotide)
Class: oxidoreductase
Keywords: protein-substrate-cofactor complex, oxidoreductase
Deposited on 2006-01-06, released 2006-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed):
    • GB AAG17668 (0-End)
      • see remark 999 (183)
    Domains in SCOPe 2.07: d2fm3a3, d2fm3a4
  • Chain 'B':
    Compound: lactate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed):
    • GB AAG17668 (0-End)
      • see remark 999 (183)
    Domains in SCOPe 2.07: d2fm3b3, d2fm3b4
  • Heterogens: NAD, PYR, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fm3A (A:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnapaaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fm3A (A:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fm3B (B:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnapaaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fm3B (B:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnap