PDB entry 2flw

View 2flw on RCSB PDB site
Description: Crystal structure of Mg2+ and BeF3- ound CheY in complex with CheZ 200-214 solved from a F432 crystal grown in Hepes (pH 7.5)
Class: signaling protein
Keywords: chemotaxis; bef(3)(-)-bound chey; chey-chez peptide complex
Deposited on 2006-01-06, released 2006-05-23
The last revision prior to the SCOP 1.75 freeze date was dated 2006-06-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.213
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY
    Species: Salmonella enterica subsp. enterica serovar Typhimurium
    Gene: cheY
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2flwa1
  • Chain 'B':
    Compound: C-terminal 15-mer from Chemotaxis protein cheZ
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, SO4, BEF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2flwA (A:)
    madkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnm
    pnmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekl
    nkifeklgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2flwA (A:)
    adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
    nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
    kifeklgm
    

  • Chain 'B':
    No sequence available.