PDB entry 2flw

View 2flw on RCSB PDB site
Description: Crystal structure of Mg2+ and BeF3- ound CheY in complex with CheZ 200-214 solved from a F432 crystal grown in Hepes (pH 7.5)
Class: signaling protein
Keywords: chemotaxis; bef(3)(-)-bound chey; chey-chez peptide complex
Deposited on 2006-01-06, released 2006-05-23
The last revision prior to the SCOP 1.75 freeze date was dated 2006-06-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.213
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chemotaxis protein cheY
  Species: Salmonella enterica subsp. enterica serovar Typhimurium
  Gene: cheY
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A2D5 (1-128)
  Domains in SCOP 1.75: d2flwa1
• Chain 'B':
  Compound: C-terminal 15-mer from Chemotaxis protein cheZ
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07800 (Start-14)
• Heterogens: MG, SO4, BEF, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2flwA (A:)
  madkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnm
  pnmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekl
  nkifeklgm
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2flwA (A:)
  adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
  nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
  kifeklgm
  

  
  
• Chain 'B':
  No sequence available.