PDB entry 2flu

View 2flu on RCSB PDB site
Description: Crystal Structure of the Kelch-Neh2 Complex
Class: ligase
Keywords: Kelch domain,protein-peptide complex, beta-propeller, LIGASE
Deposited on 2006-01-06, released 2006-08-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.18
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: Nrf2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Kelch-like ECH-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAH15945 (Start-307)
    Domains in SCOPe 2.01: d2flux1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'P':
    No sequence available.

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2fluX (X:)
    gsshhhhhhssglvprgshapkvgrliytaggyfrqslsyleaynpsdgtwlrladlqvp
    rsglagcvvggllyavggrnnspdgntdssaldcynpmtnqwspcapmsvprnrigvgvi
    dghiyavggshgcihhnsveryeperdewhlvapmltrrigvgvavlnrllyavggfdgt
    nrlnsaecyypernewrmitamntirsgagvcvlhnciyaaggydgqdqlnsverydvet
    etwtfvapmkhrrsalgitvhqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgr
    sgvgvavt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fluX (X:)
    grliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrnnsp
    dgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsverye
    perdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitamn
    tirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitvhqg
    riyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt