PDB entry 2fln

View 2fln on RCSB PDB site
Description: binary complex of catalytic core of human DNA polymerase iota with DNA (template A)
Class: replication/DNA
Keywords: DNA Polymerase, lesion bypass, binary complex, template A, REPLICATION-DNA COMPLEX
Deposited on 2006-01-06, released 2006-12-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.231
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase iota
    Species: Homo sapiens [TaxId:9606]
    Gene: POLI, RAD30B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2flna1, d2flna2
  • Chain 'P':
    Compound: DNA primer strand
  • Chain 'T':
    Compound: DNA template strand
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2flnA (A:)
    meladvgaaassqgvhdqvlptpnassrvivhvdldcfyaqvemisnpelkdkplgvqqk
    ylvvtcnyearklgvkklmnvrdakekcpqlvlvngedltryremsykvtelleefspvv
    erlgfdenfvdltemvekrlqqlqsdelsavtvsghvynnqsinlldvlhirllvgsqia
    aemreamynqlgltgcagvasnkllaklvsgvfkpnqqtvllpescqhlihslnhikeip
    gigyktakclealginsvrdlqtfspkilekelgisvaqriqklsfgednspvilsgppq
    sfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirryssekhygresr
    qcpipshviqklgtgnydvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlkalntak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2flnA (A:)
    ssrvivhvdldcfyaqvemisnpelkdkplgvqqkylvvtcnyearklgvkklmnvrdak
    ekcpqlvlvngedltryremsykvtelleefspvverlgfdenfvdltemvekrlqqlqs
    delsavtvsghvynnqsinlldvlhirllvgsqiaaemreamynqlgltgcagvasnkll
    aklvsgvfkpnqqtvllpescqhlihslnhikeipgigyktakclealginsvrdlqtfs
    pkilekelgisvaqriqklsfgednspvilsgppqsfseedsfkkcsseveaknkieell
    asllnrvcqdgrkphtvrliirrygresrqcpipshviqvmtpmvdilmklfrnmtllsv
    cfcnlk
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.