PDB entry 2fli

View 2fli on RCSB PDB site
Description: The crystal structure of D-ribulose 5-phosphate 3-epimerase from Streptococus pyogenes complexed with D-xylitol 5-phosphate
Class: isomerase
Keywords: D-ribulose 5-phosphate 3-epimerase,(beta/alpha)8-barrel, D-xylitol 5-phosphate
Deposited on 2006-01-06, released 2006-03-07
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.224
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose-phosphate 3-epimerase
    Species: Streptococcus pyogenes
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2flia1
  • Chain 'B':
    Compound: ribulose-phosphate 3-epimerase
    Species: Streptococcus pyogenes
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2flib1
  • Chain 'C':
    Compound: ribulose-phosphate 3-epimerase
    Species: Streptococcus pyogenes
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2flic1
  • Chain 'D':
    Compound: ribulose-phosphate 3-epimerase
    Species: Streptococcus pyogenes
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2flid1
  • Chain 'E':
    Compound: ribulose-phosphate 3-epimerase
    Species: Streptococcus pyogenes
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2flie1
  • Chain 'F':
    Compound: ribulose-phosphate 3-epimerase
    Species: Streptococcus pyogenes
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2flif1
  • Chain 'G':
    Compound: ribulose-phosphate 3-epimerase
    Species: Streptococcus pyogenes
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2flig1
  • Chain 'H':
    Compound: ribulose-phosphate 3-epimerase
    Species: Streptococcus pyogenes
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2flih1
  • Chain 'I':
    Compound: ribulose-phosphate 3-epimerase
    Species: Streptococcus pyogenes
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2flii1
  • Chain 'J':
    Compound: ribulose-phosphate 3-epimerase
    Species: Streptococcus pyogenes
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2flij1
  • Chain 'K':
    Compound: ribulose-phosphate 3-epimerase
    Species: Streptococcus pyogenes
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2flik1
  • Chain 'L':
    Compound: ribulose-phosphate 3-epimerase
    Species: Streptococcus pyogenes
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2flil1
  • Heterogens: ZN, DX5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fliA (A:)
    mstlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhs
    klvfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgt
    pataleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvd
    nktiracyeaganvfvagsylfkasdlvsqvqtlrtalnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fliA (A:)
    tlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhskl
    vfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgtpa
    taleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvdnk
    tiracyeaganvfvagsylfkasdlvsqvqtlrtaln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fliB (B:)
    mstlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhs
    klvfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgt
    pataleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvd
    nktiracyeaganvfvagsylfkasdlvsqvqtlrtalnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fliB (B:)
    stlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhsk
    lvfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgtp
    ataleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvdn
    ktiracyeaganvfvagsylfkasdlvsqvqtlrtal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fliC (C:)
    mstlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhs
    klvfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgt
    pataleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvd
    nktiracyeaganvfvagsylfkasdlvsqvqtlrtalnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fliC (C:)
    stlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhsk
    lvfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgtp
    ataleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvdn
    ktiracyeaganvfvagsylfkasdlvsqvqtlrtalnv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fliD (D:)
    mstlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhs
    klvfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgt
    pataleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvd
    nktiracyeaganvfvagsylfkasdlvsqvqtlrtalnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fliD (D:)
    stlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhsk
    lvfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgtp
    ataleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvdn
    ktiracyeaganvfvagsylfkasdlvsqvqtlrtal
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2fliE (E:)
    mstlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhs
    klvfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgt
    pataleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvd
    nktiracyeaganvfvagsylfkasdlvsqvqtlrtalnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fliE (E:)
    tlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhskl
    vfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgtpa
    taleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvdnk
    tiracyeaganvfvagsylfkasdlvsqvqtlrtal
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2fliF (F:)
    mstlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhs
    klvfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgt
    pataleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvd
    nktiracyeaganvfvagsylfkasdlvsqvqtlrtalnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fliF (F:)
    tlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhskl
    vfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgtpa
    taleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvdnk
    tiracyeaganvfvagsylfkasdlvsqvqtlrtal
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2fliG (G:)
    mstlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhs
    klvfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgt
    pataleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvd
    nktiracyeaganvfvagsylfkasdlvsqvqtlrtalnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fliG (G:)
    stlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhsk
    lvfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgtp
    ataleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvdn
    ktiracyeaganvfvagsylfkasdlvsqvqtlrtaln
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2fliH (H:)
    mstlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhs
    klvfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgt
    pataleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvd
    nktiracyeaganvfvagsylfkasdlvsqvqtlrtalnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fliH (H:)
    tlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhskl
    vfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgtpa
    taleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvdnk
    tiracyeaganvfvagsylfkasdlvsqvqtlrtal
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2fliI (I:)
    mstlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhs
    klvfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgt
    pataleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvd
    nktiracyeaganvfvagsylfkasdlvsqvqtlrtalnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fliI (I:)
    tlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhskl
    vfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgtpa
    taleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvdnk
    tiracyeaganvfvagsylfkasdlvsqvqtlrtaln
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2fliJ (J:)
    mstlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhs
    klvfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgt
    pataleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvd
    nktiracyeaganvfvagsylfkasdlvsqvqtlrtalnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fliJ (J:)
    stlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhsk
    lvfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgtp
    ataleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvdn
    ktiracyeaganvfvagsylfkasdlvsqvqtlrtaln
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2fliK (K:)
    mstlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhs
    klvfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgt
    pataleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvd
    nktiracyeaganvfvagsylfkasdlvsqvqtlrtalnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fliK (K:)
    tlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhskl
    vfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgtpa
    taleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvdnk
    tiracyeaganvfvagsylfkasdlvsqvqtlrtal
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2fliL (L:)
    mstlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhs
    klvfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgt
    pataleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvd
    nktiracyeaganvfvagsylfkasdlvsqvqtlrtalnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fliL (L:)
    tlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhskl
    vfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgtpa
    taleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvdnk
    tiracyeaganvfvagsylfkasdlvsqvqtlrtalnv