PDB entry 2fla

View 2fla on RCSB PDB site
Description: Structure of thereduced HiPIP from thermochromatium tepidum at 0.95 angstrom resolution
Class: electron transport
Keywords: iron-sulfur protein, electron transport
Deposited on 2006-01-05, released 2006-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: N/A
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high-potential iron-sulfur protein
    Species: Thermochromatium tepidum [TaxId:1050]
    Gene: hip
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2flaa_
  • Heterogens: SO4, SF4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2flaA (A:)
    aapanavtaddptaialkynqdatkservaaarpglppeeqhcancqfmqanvgegdwkg
    cqlfpgklinvngwcaswtlkag