PDB entry 2fkz

View 2fkz on RCSB PDB site
Description: Reduced (All Ferrous) form of the Azotobacter vinelandii bacterioferritin
Class: metal binding protein
Keywords: Ferritin, Bacterioferritin, Ferroxidase, Diiron site, Iron transport, METAL BINDING PROTEIN
Deposited on 2006-01-05, released 2006-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fkza_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fkzb_
  • Chain 'C':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fkzc_
  • Chain 'D':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fkzd_
  • Chain 'E':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fkze_
  • Chain 'F':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fkzf_
  • Chain 'G':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fkzg_
  • Chain 'H':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fkzh_
  • Heterogens: FE2, MG, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fkzA (A:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fkzB (B:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fkzC (C:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fkzD (D:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fkzE (E:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fkzF (F:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fkzG (G:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fkzH (H:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd