PDB entry 2fkx

View 2fkx on RCSB PDB site
Description: Ribosomal protein s15 from thermus thermophilus, nmr recalculated structure
Class: structural protein
Keywords: ribosomal protein, RNA-binding protein, rRNA-binding protein, structural protein
Deposited on 2006-01-05, released 2006-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S15
    Species: Thermus thermophilus [TaxId:274]
    Gene: rpsO, rps15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fkxa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fkxA (A:)
    pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyralieklgirg