PDB entry 2fkp

View 2fkp on RCSB PDB site
Description: The mutant G127C-T313C of Deinococcus Radiodurans N-acylamino acid racemase
Class: isomerase
Keywords: N-Acylamino Acid Racemase, Deinococcus Radiodurans
Deposited on 2006-01-05, released 2006-01-24
The last revision prior to the SCOP 1.75 freeze date was dated 2006-01-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acylamino acid racemase
    Species: Deinococcus Radiodurans
    Database cross-references and differences (RAF-indexed):
    • GB NP_293770 (Start-374)
      • see remark 999 (93)
      • engineered (126)
      • see remark 999 (147)
      • see remark 999 (157)
      • see remark 999 (251)
      • engineered (312)
      • see remark 999 (314)
    Domains in SCOP 1.75: d2fkpa1, d2fkpa2
  • Chain 'B':
    Compound: N-acylamino acid racemase
    Species: Deinococcus Radiodurans
    Database cross-references and differences (RAF-indexed):
    • GB NP_293770 (Start-374)
      • see remark 999 (93)
      • engineered (126)
      • see remark 999 (147)
      • see remark 999 (157)
      • see remark 999 (251)
      • engineered (312)
      • see remark 999 (314)
  • Chain 'C':
    Compound: N-acylamino acid racemase
    Species: Deinococcus Radiodurans
    Database cross-references and differences (RAF-indexed):
    • GB NP_293770 (Start-374)
      • see remark 999 (93)
      • engineered (126)
      • see remark 999 (147)
      • see remark 999 (157)
      • see remark 999 (251)
      • engineered (312)
      • see remark 999 (314)
  • Chain 'D':
    Compound: N-acylamino acid racemase
    Species: Deinococcus Radiodurans
    Database cross-references and differences (RAF-indexed):
    • GB NP_293770 (Start-374)
      • see remark 999 (93)
      • engineered (126)
      • see remark 999 (147)
      • see remark 999 (157)
      • see remark 999 (251)
      • engineered (312)
      • see remark 999 (314)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fkpA (A:)
    mahtgrmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearp
    myreetiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwar
    tlgvplctllgghkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpv
    ratreafpdirltvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirt
    plcldesvasasdarkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmle
    sgigrahnihlsclsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldr
    eflatvteaqeehra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fkpA (A:)
    rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
    gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplctllgghke
    qvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirltvd
    ansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasasdar
    kalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihlscls
    nfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqeehra
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.