PDB entry 2fko

View 2fko on RCSB PDB site
Description: Structure of PH1591 from Pyrococcus horikoshii OT3
Class: lyase
Keywords: beta-helix, carbonic anhydrase, Lithium, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LYASE
Deposited on 2006-01-05, released 2007-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.192
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 173aa long hypothetical ferripyochelin binding protein
  Species: Pyrococcus horikoshii [TaxId:70601]
  Database cross-references and differences (RAF-indexed):
  • GB BAA30703 (0-172)
  Domains in SCOPe 2.08: d2fkoa_
• Heterogens: ZN, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fkoA (A:)
  maiyeingkkprihpsafvdenavvigdvvleektsvwpsavlrgdieqiyvgkysnvqd
  nvsihtshgypteigeyvtighnamvhgakvgnyviigissvildgakigdhviigagav
  vppnkeipdyslvlgvpgkvvrqlteeeiewtkknaeiyvelaekhikgrkri