PDB entry 2fki

View 2fki on RCSB PDB site
Description: NMR Structure of Protein yjbR from Escherichia coli; Northeast Structural Genomics Consortium Target ER226
Class: structural genomics, unknown function
Keywords: NESG, ER226, GFT-NMR, ALPHA-BETA, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2006-01-04, released 2006-02-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein yjbR
  Species: Escherichia coli [TaxId:562]
  Gene: yjbR
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AF50 (0-117)
  Domains in SCOPe 2.08: d2fkia1

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2fkiA (A:)
  mtisellqycmakpgaeqsvhndwkatqikvedvlfamvkevenrpavslktspelaell
  rqqhsdvrpsrhlnkahwstvyldgslpdsqiyylvdasyqqavnllpeekrkllvqlle
  hhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2fkiA (A:)
  mtisellqycmakpgaeqsvhndwkatqikvedvlfamvkevenrpavslktspelaell
  rqqhsdvrpsrhlnkahwstvyldgslpdsqiyylvdasyqqavnllpeekrkllvql