PDB entry 2fka

View 2fka on RCSB PDB site
Description: Crystal structure of Mg(2+) and BeF(3)(-)-bound CheY in complex with CheZ(200-214) solved from a F432 crystal grown in CAPS (pH 10.5)
Class: signaling protein
Keywords: chemotaxis; bef(3)(-)-bound chey; chey-chez peptide complex, signaling protein
Deposited on 2006-01-04, released 2006-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: cheY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fkaa_
  • Chain 'B':
    Compound: C-terminal 15-mer from Chemotaxis protein cheZ
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, SO4, CXS, BEF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2fkaA (A:)
madkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnm
pnmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekl
nkifeklgm

    Sequence, based on observed residues (ATOM records): (download) 
    >2fkaA (A:)
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

  • Chain 'B':
    No sequence available.