PDB entry 2fk6

View 2fk6 on RCSB PDB site
Description: Crystal Structure of RNAse Z/tRNA(Thr) complex
Class: hydrolase/RNA
Keywords: PROTEIN-tRNA COMPLEX; ZINC-DEPENDENT METAL HYDROLASE; tRNA MATURASE, HYDROLASE-RNA COMPLEX
Deposited on 2006-01-04, released 2006-03-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.25
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease z
    Species: Bacillus subtilis [TaxId:1423]
    Gene: RNZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54548 (0-306)
      • engineered (45)
      • engineered (64)
      • engineered (227)
    Domains in SCOPe 2.05: d2fk6a1
  • Chain 'R':
    Compound: tRNA(thr)
    Species: synthetic, synthetic
  • Heterogens: ZN, MES, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fk6A (A:)
    mellflgtgagipakarnvtsvalklleerrsvwlfdcgeatqhqmlhttikprkiekif
    ithmagdhvyglpgllgsrsfqggedeltvygpkgikafietslavtkthltyplaiqei
    eegivfeddqfivtavsvihgveafgyrvqekdvpgslkadvlkemnippgpvyqkikkg
    etvtledgriingndfleppkkgrsvvfsgdtrvsdklkelardcdvmvheatfakedrk
    laydyyhstteqaavtakearakqlilthisaryqgdaslelqkeavdvfpnsvaaydfl
    evnvprgklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk6A (A:)
    mellflgtgagipakarnvtsvalklleerrsvwlfdcgeatqhqmlhttikprkiekif
    ithmagdhvyglpgllgsrsfqggedeltvygpkgikafietslavtkthltyplaiqei
    eegivfeddqfivtavsvihgveafgyrvqekdvpgslkadvlkemnippgpvyqkikkg
    etvtledgriingndfleppkkgrsvvfsgdtrvsdklkelardcdvmvheatfakedrk
    laydyyhstteqaavtakearakqlilthisaryqgdaslelqkeavdvfpnsvaaydfl
    evnvprg
    

  • Chain 'R':
    No sequence available.