PDB entry 2fk4

View 2fk4 on RCSB PDB site
Description: Solution structure of the C-terminal zinc binding domain of the HPV16 E6 oncoprotein
Class: Metal binding protein, Oncoprotein
Keywords: zinc binding domain, oncoprotein
Deposited on 2006-01-04, released 2006-01-24
The last revision prior to the SCOP 1.75 freeze date was dated 2006-04-25, with a file datestamp of 2007-07-20.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein E6
  Species: Human papillomavirus type 16
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03126 (3-End)
    • cloning artifact (1-2)
    • engineered (3)
    • engineered (20)
    • engineered (34)
    • engineered (63)
  Domains in SCOP 1.75: d2fk4a1
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2fk4A (A:)
  gamsyslygttleqqynkplsdllircincqkplspeekqrhldkkqrfhnirgrwtgrc
  mscsrssrtrretql
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2fk4A (A:)
  amsyslygttleqqynkplsdllircincqkplspeekqrhldkkqrfhnirgrwtgrcm
  scsrssr