PDB entry 2fk3

View 2fk3 on RCSB PDB site
Description: Structure of the Alzheimer's Amyloid Precursor Protein (APP) Copper Binding Domain in 'large unit cell' form
Class: metal binding protein
Keywords: Alpha-Beta Two-layered Sandwich, Non-Crystallographic Symmetry, METAL BINDING PROTEIN
Deposited on 2006-01-04, released 2007-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.208
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amyloid beta A4 protein precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: APP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05067 (2-58)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d2fk3a1, d2fk3a2
  • Chain 'B':
    Compound: Amyloid beta A4 protein precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: APP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05067 (2-58)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d2fk3b1, d2fk3b2
  • Chain 'C':
    Compound: Amyloid beta A4 protein precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: APP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05067 (2-58)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d2fk3c1, d2fk3c2
  • Chain 'D':
    Compound: Amyloid beta A4 protein precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: APP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05067 (2-58)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d2fk3d1, d2fk3d2
  • Chain 'E':
    Compound: Amyloid beta A4 protein precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: APP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05067 (2-58)
      • cloning artifact (1)
    Domains in SCOPe 2.08: d2fk3e1, d2fk3e2
  • Chain 'F':
    Compound: Amyloid beta A4 protein precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: APP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05067 (2-58)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d2fk3f1, d2fk3f2
  • Chain 'G':
    Compound: Amyloid beta A4 protein precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: APP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05067 (2-58)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d2fk3g1, d2fk3g2
  • Chain 'H':
    Compound: Amyloid beta A4 protein precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: APP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05067 (2-58)
      • cloning artifact (1)
    Domains in SCOPe 2.08: d2fk3h1, d2fk3h2
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fk3A (A:)
    eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fk3B (B:)
    eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fk3C (C:)
    eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fk3D (D:)
    eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2fk3E (E:)
    eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk3E (E:)
    ackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fk3F (F:)
    eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fk3G (G:)
    eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2fk3H (H:)
    eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk3H (H:)
    ackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl