PDB entry 2fk3

View 2fk3 on RCSB PDB site
Description: Structure of the Alzheimer's Amyloid Precursor Protein (APP) Copper Binding Domain in 'large unit cell' form
Class: metal binding protein
Keywords: Alpha-Beta Two-layered Sandwich, Non-Crystallographic Symmetry, METAL BINDING PROTEIN
Deposited on 2006-01-04, released 2007-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.208
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Amyloid beta A4 protein precursor
  Species: Homo sapiens [TaxId:9606]
  Gene: APP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05067 (2-58)
    • cloning artifact (0-1)
  Domains in SCOPe 2.08: d2fk3a1, d2fk3a2
• Chain 'B':
  Compound: Amyloid beta A4 protein precursor
  Species: Homo sapiens [TaxId:9606]
  Gene: APP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05067 (2-58)
    • cloning artifact (0-1)
  Domains in SCOPe 2.08: d2fk3b1, d2fk3b2
• Chain 'C':
  Compound: Amyloid beta A4 protein precursor
  Species: Homo sapiens [TaxId:9606]
  Gene: APP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05067 (2-58)
    • cloning artifact (0-1)
  Domains in SCOPe 2.08: d2fk3c1, d2fk3c2
• Chain 'D':
  Compound: Amyloid beta A4 protein precursor
  Species: Homo sapiens [TaxId:9606]
  Gene: APP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05067 (2-58)
    • cloning artifact (0-1)
  Domains in SCOPe 2.08: d2fk3d1, d2fk3d2
• Chain 'E':
  Compound: Amyloid beta A4 protein precursor
  Species: Homo sapiens [TaxId:9606]
  Gene: APP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05067 (2-58)
    • cloning artifact (1)
  Domains in SCOPe 2.08: d2fk3e1, d2fk3e2
• Chain 'F':
  Compound: Amyloid beta A4 protein precursor
  Species: Homo sapiens [TaxId:9606]
  Gene: APP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05067 (2-58)
    • cloning artifact (0-1)
  Domains in SCOPe 2.08: d2fk3f1, d2fk3f2
• Chain 'G':
  Compound: Amyloid beta A4 protein precursor
  Species: Homo sapiens [TaxId:9606]
  Gene: APP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05067 (2-58)
    • cloning artifact (0-1)
  Domains in SCOPe 2.08: d2fk3g1, d2fk3g2
• Chain 'H':
  Compound: Amyloid beta A4 protein precursor
  Species: Homo sapiens [TaxId:9606]
  Gene: APP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05067 (2-58)
    • cloning artifact (1)
  Domains in SCOPe 2.08: d2fk3h1, d2fk3h2
• Heterogens: CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fk3A (A:)
  eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fk3B (B:)
  eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fk3C (C:)
  eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fk3D (D:)
  eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl
  

  
  
• Chain 'E':
  Sequence, based on SEQRES records: (download)
  

  >2fk3E (E:)
  eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2fk3E (E:)
  ackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fk3F (F:)
  eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fk3G (G:)
  eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl
  

  
  
• Chain 'H':
  Sequence, based on SEQRES records: (download)
  

  >2fk3H (H:)
  eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2fk3H (H:)
  ackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl