PDB entry 2fk2

View 2fk2 on RCSB PDB site
Description: Structure of the Alzheimer's Amyloid Precursor Protein (APP) Copper Binding Domain in 'small unit cell' form, Cu(I)-bound
Class: apoptosis
Keywords: Alpha-Beta Two-layered Sandwich, Cu(I) coordination, APOPTOSIS
Deposited on 2006-01-03, released 2007-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.19
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amyloid beta A4 protein precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: APP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05067 (2-58)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d2fk2a1, d2fk2a2
  • Heterogens: CU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fk2A (A:)
    eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl