PDB entry 2fk1

View 2fk1 on RCSB PDB site
Description: Structure of the Alzheimer's Amyloid Precursor Protein (APP) Copper Binding Domain in 'small unit cell' form, Cu(II)-bound
Class: metal binding protein
Keywords: Alpha-Beta Two-layered Sandwich, Cu(II) coordination, METAL BINDING PROTEIN
Deposited on 2006-01-03, released 2007-01-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.188
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Amyloid beta A4 protein precursor
  Species: Homo sapiens [TaxId:9606]
  Gene: APP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05067 (2-58)
    • cloning artifact (0-1)
  Domains in SCOPe 2.05: d2fk1a_
• Heterogens: CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fk1A (A:)
  eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl